PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002200.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 349aa    MW: 40493 Da    PI: 6.9642
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002200.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.43.2e-5471311129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              +ppGfrFhPtdeelv++yL+kkv+ k+++l +vike+d+y++ePwdL+ +  +e+++wyfFs++dkky+tg+r+nratk+g+Wkat
  Itr_sc002200.1_g00003.1   7 VPPGFRFHPTDEELVDYYLRKKVALKRIDL-DVIKEIDLYNIEPWDLQGC--EEQSDWYFFSHKDKKYPTGTRTNRATKAGFWKAT 89 
                              69****************************.9***************844..4678****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              g+dk+++s k+ l+g++ktLvfykgrap+g k+dW+mheyrle
  Itr_sc002200.1_g00003.1  90 GRDKAIYS-KHCLIGMRKTLVFYKGRAPNGLKSDWIMHEYRLE 131
                              ********.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-585158IPR003441NAC domain
PROSITE profilePS5100557.1727158IPR003441NAC domain
PfamPF023652.1E-288130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MNSLSHVPPG FRFHPTDEEL VDYYLRKKVA LKRIDLDVIK EIDLYNIEPW DLQGCEEQSD  60
WYFFSHKDKK YPTGTRTNRA TKAGFWKATG RDKAIYSKHC LIGMRKTLVF YKGRAPNGLK  120
SDWIMHEYRL ETNENGAPQA IGHPWQEEGW VVCRAFKKRM PTMARKEGAD HESPLCSNGW  180
YDDQISSFIP SDFESPRRIS THHHHHHPNY NNINPPPYNM NPHFLNSCKQ ELHHHQLHYN  240
IIVPHEHEHH PPFIHQSSSS SLPQLESPKL PHPTTQFHMI NSSSSSSPSL LYCNDQSVGD  300
DHDHLTTDWR VLDKFVASQL MSHDEEDNNN NNNGDGKETS LRASSSFQP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-48615914169Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093669.11e-122NAC domain-containing protein 7
SwissprotF4HYV51e-119NAC26_ARATH; NAC domain-containing protein 26
TrEMBLW9R2401e-122W9R240_9R
STRINGGLYMA17G14700.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-102NAC 007